PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC7577_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 277aa    MW: 31348.6 Da    PI: 8.3864
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC7577_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-172572148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+lv+++kq   g+W+t +++ g+ R++k+c++rw +yl
       RrC7577_p1 25 KGPWTPEEDEILVEYIKQNSHGSWRTLPKKSGLLRCGKSCRLRWTNYL 72
                     79******************************99************97 PP

2Myb_DNA-binding51.52.3e-1678123148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE++l v++++ lG++ W++Ia+ ++ gRt++++k+ w+++l
       RrC7577_p1  78 RGPFTLEEEKLVVQLHAILGNR-WAAIAAQLP-GRTDNEIKNLWNTHL 123
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.8E-241675IPR009057Homeodomain-like
PROSITE profilePS5129416.3312072IPR017930Myb domain
SuperFamilySSF466892.79E-2922119IPR009057Homeodomain-like
SMARTSM007176.0E-132474IPR001005SANT/Myb domain
PfamPF002493.4E-142572IPR001005SANT/Myb domain
CDDcd001673.40E-92772No hitNo description
PROSITE profilePS5129425.173127IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2576127IPR009057Homeodomain-like
SMARTSM007171.3E-1477125IPR001005SANT/Myb domain
PfamPF002494.9E-1578123IPR001005SANT/Myb domain
CDDcd001672.48E-1080123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MFVHLASEVI KMGRRPCCDK KGLKKGPWTP EEDEILVEYI KQNSHGSWRT LPKKSGLLRC  60
GKSCRLRWTN YLRPDIKRGP FTLEEEKLVV QLHAILGNRW AAIAAQLPGR TDNEIKNLWN  120
THLKKRLLSM GLHPKTHEPL PSYGFAKQAP ASPTTRHMAQ WESARVEAEA RLSRESTLVK  180
SDCDHFLRIW NSEIGESFRN IAPSDQSTTS QSLSSRTTSS SSTLVGKEIV VRTHGSDSSP  240
CWNNLEDVSS DSAFQLLLDF PISDDDMSFL EENISLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28231275108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196011e-152AY519601.1 Arabidopsis thaliana MYB transcription factor (At3g61250) mRNA, complete cds.
GenBankBT0331291e-152BT033129.1 Arabidopsis thaliana unknown protein (At3g61250) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006402502.11e-167hypothetical protein EUTSA_v10006126mg
TrEMBLV4L0Z81e-166V4L0Z8_EUTSA; Uncharacterized protein
STRINGBra003443.1-P1e-162(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69822643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-153myb domain protein 17